Lineage for d1bjna_ (1bjn A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26419Family c.67.1.4: omega-Amino acid:pyruvate aminotransferase-like [53417] (11 proteins)
  6. 26477Protein Phosphoserine aminotransferase, PSAT [53426] (2 species)
  7. 26480Species Escherichia coli [TaxId:562] [53428] (2 PDB entries)
  8. 26481Domain d1bjna_: 1bjn A: [34469]

Details for d1bjna_

PDB Entry: 1bjn (more details), 2.3 Å

PDB Description: structure of phosphoserine aminotransferase from escherichia coli

SCOP Domain Sequences for d1bjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli}
qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg

SCOP Domain Coordinates for d1bjna_:

Click to download the PDB-style file with coordinates for d1bjna_.
(The format of our PDB-style files is described here.)

Timeline for d1bjna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bjnb_