Lineage for d1bjna_ (1bjn A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. Species Escherichia coli [TaxId:562] [53428] (2 PDB entries)
  8. Domain d1bjna_: 1bjn A: [34469]

Details for d1bjna_

PDB Entry: 1bjn (more details), 2.3 Å

PDB Description: structure of phosphoserine aminotransferase from escherichia coli
PDB Compounds: (A:) phosphoserine aminotransferase

SCOPe Domain Sequences for d1bjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]}
qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg

SCOPe Domain Coordinates for d1bjna_ are not available.

Timeline for d1bjna_:

Domains from other chains:
(mouse over for more information)
d1bjnb_