Lineage for d1je3a_ (1je3 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864751Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 864840Superfamily d.68.3: SirA-like [64307] (1 family) (S)
  5. 864841Family d.68.3.3: SirA-like [88852] (4 proteins)
    predicted redox protein, regulator of disulfide bond formation
  6. 864848Protein hypothetical protein YedF (EC005) [75475] (1 species)
  7. 864849Species Escherichia coli [TaxId:562] [75476] (1 PDB entry)
  8. 864850Domain d1je3a_: 1je3 A: [71637]
    structural genomics

Details for d1je3a_

PDB Entry: 1je3 (more details)

PDB Description: solution structure of ec005 from escherichia coli
PDB Compounds: (A:) hypothetical 8.6 kda protein in amya-flie intergenic region

SCOP Domain Sequences for d1je3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je3a_ d.68.3.3 (A:) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]}
mgsshhhhhhssglvprgshmknivpdyrldmvgepcpypavatleampqlkkgeilevv
sdcpqsinnipldarnhgytvldiqqdgptiryliqk

SCOP Domain Coordinates for d1je3a_:

Click to download the PDB-style file with coordinates for d1je3a_.
(The format of our PDB-style files is described here.)

Timeline for d1je3a_: