PDB entry 1je3

View 1je3 on RCSB PDB site
Description: Solution Structure of EC005 from Escherichia coli
Class: structural genomics
Keywords: mixed alpha-beta structure, structural genomics
Deposited on 2001-06-15, released 2002-03-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical 8.6 kda protein in amya-flie intergenic region
  Species: Escherichia coli
  Gene: YEDF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA31 (20-96)
    • his tag (0-19)
  Domains in SCOP 1.75: d1je3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1je3A (A:)
  mgsshhhhhhssglvprgshmknivpdyrldmvgepcpypavatleampqlkkgeilevv
  sdcpqsinnipldarnhgytvldiqqdgptiryliqk