Lineage for d1je3a_ (1je3 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193248Fold d.68: IF3-like [55199] (4 superfamilies)
  4. 193287Superfamily d.68.3: SirA-like [64307] (2 families) (S)
  5. 193292Family d.68.3.2: YedF-like [69750] (2 proteins)
  6. 193296Protein hypothetical protein YedF (EC005) [75475] (1 species)
  7. 193297Species Escherichia coli [TaxId:562] [75476] (1 PDB entry)
  8. 193298Domain d1je3a_: 1je3 A: [71637]

Details for d1je3a_

PDB Entry: 1je3 (more details)

PDB Description: solution structure of ec005 from escherichia coli

SCOP Domain Sequences for d1je3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je3a_ d.68.3.2 (A:) hypothetical protein YedF (EC005) {Escherichia coli}
mgsshhhhhhssglvprgshmknivpdyrldmvgepcpypavatleampqlkkgeilevv
sdcpqsinnipldarnhgytvldiqqdgptiryliqk

SCOP Domain Coordinates for d1je3a_:

Click to download the PDB-style file with coordinates for d1je3a_.
(The format of our PDB-style files is described here.)

Timeline for d1je3a_: