Lineage for d1je3a1 (1je3 A:21-97)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523683Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2523961Superfamily d.68.3: SirA-like [64307] (1 family) (S)
  5. 2523962Family d.68.3.3: SirA-like [88852] (5 proteins)
    predicted redox protein, regulator of disulfide bond formation
  6. 2523969Protein hypothetical protein YedF (EC005) [75475] (1 species)
  7. 2523970Species Escherichia coli [TaxId:562] [75476] (1 PDB entry)
  8. 2523971Domain d1je3a1: 1je3 A:21-97 [71637]
    Other proteins in same PDB: d1je3a2
    structural genomics

Details for d1je3a1

PDB Entry: 1je3 (more details)

PDB Description: Solution Structure of EC005 from Escherichia coli
PDB Compounds: (A:) hypothetical 8.6 kda protein in amya-flie intergenic region

SCOPe Domain Sequences for d1je3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je3a1 d.68.3.3 (A:21-97) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]}
mknivpdyrldmvgepcpypavatleampqlkkgeilevvsdcpqsinnipldarnhgyt
vldiqqdgptiryliqk

SCOPe Domain Coordinates for d1je3a1:

Click to download the PDB-style file with coordinates for d1je3a1.
(The format of our PDB-style files is described here.)

Timeline for d1je3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1je3a2