Lineage for d1ae7a_ (1ae7 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 777960Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 778048Protein Snake phospholipase A2 [48624] (35 species)
  7. 778131Species Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId:8663] [48631] (1 PDB entry)
    presynaptic neurotoxic phospholipase A2
  8. 778132Domain d1ae7a_: 1ae7 A: [19553]
    complexed with so4

Details for d1ae7a_

PDB Entry: 1ae7 (more details), 2 Å

PDB Description: notexin, a presynaptic neurotoxic phospholipase a2
PDB Compounds: (A:) phospholipase a2

SCOP Domain Sequences for d1ae7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]}
nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc
fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq

SCOP Domain Coordinates for d1ae7a_:

Click to download the PDB-style file with coordinates for d1ae7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ae7a_: