Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.5: PP-loop ATPase [82359] (2 proteins) |
Protein TilS-like protein Aq_1887 [142087] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [142088] (3 PDB entries) Uniprot O67728 1-216 |
Domain d1wy5a1: 1wy5 A:1-216 [121428] Other proteins in same PDB: d1wy5a2, d1wy5b2 |
PDB Entry: 1wy5 (more details), 2.42 Å
SCOP Domain Sequences for d1wy5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey akfkglrwvedetnyevsiprnrirhrvipelkrin
Timeline for d1wy5a1: