Lineage for d1wy5a1 (1wy5 A:1-216)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) 
share similar mode of ligand (Adenosine group) binding
can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
Family c.26.2.5: PP-loop ATPase [82359] (2 proteins) Protein TilS-like protein Aq_1887 [142087] (1 species) Species Aquifex aeolicus [TaxId:63363] [142088] (3 PDB entries)
Uniprot O67728 1-216
Domain d1wy5a1: 1wy5 A:1-216 [121428]
Other proteins in same PDB: d1wy5a2, d1wy5b2
Details for d1wy5a1
PDB Entry: 1wy5 (more details), 2.42 Å
PDB Description: Crystal structure of isoluecyl-tRNA lysidine synthetase
PDB Compounds: (A:) Hypothetical UPF0072 protein AQ_1887SCOP Domain Sequences for d1wy5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
akfkglrwvedetnyevsiprnrirhrvipelkrin
SCOP Domain Coordinates for d1wy5a1:
Click to download the PDB-style file with coordinates for d1wy5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wy5a1:
- d1wy5a1 first appeared in SCOP 1.73
- d1wy5a1 appears in SCOPe 2.01
- d1wy5a1 appears in the current release, SCOPe 2.08
View in 3D
