SCOP 1.75: Domain d1wy5b2: 1wy5 B:217-311

Lineage for d1wy5b2 (1wy5 B:217-311)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily)
   beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432

4. Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family)

5. Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins)

6. Protein TilS-like protein Aq_1887 [143132] (1 species)
   lacks the C-terminal domain of the E. coli homologue

7. Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries)
   Uniprot O67728 217-311

8. Domain d1wy5b2: 1wy5 B:217-311 [121431]
   Other proteins in same PDB: d1wy5a1, d1wy5b1
   automatically matched to 1WY5 A:217-311

Details for d1wy5b2

PDB Entry: 1wy5, 2.42 Å

PDB Description: Crystal structure of isoluecyl-tRNA lysidine synthetase

PDB Compounds: (B:) Hypothetical UPF0072 protein AQ_1887

SCOP Domain Sequences for d1wy5b2:

Sequence; same for both SEQRES and ATOM records:

>d1wy5b2 d.229.1.1 (B:217-311) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig
ekdyekvelvrsllekggevnlgkgkvlkrkerwl

Timeline for d1wy5b2:

• d1wy5b2 first appeared in SCOP 1.73
  
• d1wy5b2 appears in SCOPe 2.01
  
• d1wy5b2 appears in the current release, SCOPe 2.08