![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily) beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432 |
![]() | Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family) ![]() |
![]() | Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins) |
![]() | Protein TilS-like protein Aq_1887 [143132] (1 species) lacks the C-terminal domain of the E. coli homologue |
![]() | Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries) Uniprot O67728 217-311 |
![]() | Domain d1wy5b2: 1wy5 B:217-311 [121431] Other proteins in same PDB: d1wy5a1, d1wy5b1 automatically matched to 1WY5 A:217-311 |
PDB Entry: 1wy5 (more details), 2.42 Å
SCOPe Domain Sequences for d1wy5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wy5b2 d.229.1.1 (B:217-311) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig ekdyekvelvrsllekggevnlgkgkvlkrkerwl
Timeline for d1wy5b2: