Lineage for d1wy5a2 (1wy5 A:217-311)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880991Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily)
    beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432
  4. 880992Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family) (S)
  5. 880993Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins)
  6. 880994Protein TilS-like protein Aq_1887 [143132] (1 species)
    lacks the C-terminal domain of the E. coli homologue
  7. 880995Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries)
    Uniprot O67728 217-311
  8. 880996Domain d1wy5a2: 1wy5 A:217-311 [121429]
    Other proteins in same PDB: d1wy5a1, d1wy5b1

Details for d1wy5a2

PDB Entry: 1wy5 (more details), 2.42 Å

PDB Description: Crystal structure of isoluecyl-tRNA lysidine synthetase
PDB Compounds: (A:) Hypothetical UPF0072 protein AQ_1887

SCOP Domain Sequences for d1wy5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wy5a2 d.229.1.1 (A:217-311) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig
ekdyekvelvrsllekggevnlgkgkvlkrkerwl

SCOP Domain Coordinates for d1wy5a2:

Click to download the PDB-style file with coordinates for d1wy5a2.
(The format of our PDB-style files is described here.)

Timeline for d1wy5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wy5a1