SCOP 1.73: Domain d1wy5a1: 1wy5 A:1-216

Lineage for d1wy5a1 (1wy5 A:1-216)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.5: PP-loop ATPase [82359] (2 proteins)

6. Protein TilS-like protein Aq_1887 [142087] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [142088] (1 PDB entry)

8. Domain d1wy5a1: 1wy5 A:1-216 [121428]
   Other proteins in same PDB: d1wy5a2, d1wy5b2

Details for d1wy5a1

PDB Entry: 1wy5, 2.42 Å

PDB Description: Crystal structure of isoluecyl-tRNA lysidine synthetase

PDB Compounds: (A:) Hypothetical UPF0072 protein AQ_1887

SCOP Domain Sequences for d1wy5a1:

Sequence; same for both SEQRES and ATOM records:

>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
akfkglrwvedetnyevsiprnrirhrvipelkrin

Timeline for d1wy5a1:

• d1wy5a1 is new in SCOP 1.73
  
• d1wy5a1 appears in SCOP 1.75
  
• d1wy5a1 appears in the current release, SCOPe 2.08