Lineage for d1tiqa_ (1tiq A:)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins) 
Protein Protease synthase and sporulation negative regulatory protein PaiA [111100] (1 species) Species Bacillus subtilis [TaxId:1423] [111101] (1 PDB entry)
Uniprot P21340
Domain d1tiqa_: 1tiq A: [107010]
Structural genomics target
Details for d1tiqa_
PDB Entry: 1tiq (more details), 1.9 Å
PDB Description: crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64.
PDB Compounds: (A:) Protease synthase and sporulation negative regulatory protein PAI 1SCOP Domain Sequences for d1tiqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}
svkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssqf
ffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieiale
rnkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlile
SCOP Domain Coordinates for d1tiqa_:
Click to download the PDB-style file with coordinates for d1tiqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tiqa_:
- d1tiqa_ first appeared in SCOP 1.69
- d1tiqa_ appears in SCOP 1.73
- d1tiqa_ appears in SCOPe 2.01
- d1tiqa_ appears in the current release, SCOPe 2.08, called d1tiqa1
View in 3D
