Lineage for d1uwca_ (1uwc A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.17: Fungal lipases [53558] (4 proteins) Protein Feruloyl esterase A [102631] (1 species)
Triacylglycerol lipase homologueSpecies Aspergillus niger [TaxId:5061] [102632] (5 PDB entries)
Uniprot O42807 23-281
Domain d1uwca_: 1uwc A: [100101]
Details for d1uwca_
PDB Entry: 1uwc (more details), 1.08 Å
PDB Description: feruloyl esterase from aspergillus niger
PDB Compounds: (A:) feruloyl esterase aSCOP Domain Sequences for d1uwca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactwv
SCOP Domain Coordinates for d1uwca_:
Click to download the PDB-style file with coordinates for d1uwca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uwca_:
- d1uwca_ first appeared in SCOP 1.67
- d1uwca_ appears in SCOP 1.73
- d1uwca_ appears in SCOPe 2.01
- d1uwca_ appears in the current release, SCOPe 2.08, called d1uwca1
View in 3D
