Lineage for d1uwca_ (1uwc A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400671Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 400672Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 401034Family c.69.1.17: Fungal lipases [53558] (3 proteins)
  6. 401035Protein Feruloyl esterase A [102631] (1 species)
    Triacylglycerol lipase homologue
  7. 401036Species Aspergillus niger [102632] (2 PDB entries)
  8. 401037Domain d1uwca_: 1uwc A: [100101]

Details for d1uwca_

PDB Entry: 1uwc (more details), 1.08 Å

PDB Description: feruloyl esterase from aspergillus niger

SCOP Domain Sequences for d1uwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactwv

SCOP Domain Coordinates for d1uwca_:

Click to download the PDB-style file with coordinates for d1uwca_.
(The format of our PDB-style files is described here.)

Timeline for d1uwca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uwcb_