SCOPe 2.08: Domain d1uwca1: 1uwc A:1-260

Lineage for d1uwca1 (1uwc A:1-260)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein Feruloyl esterase A [102631] (1 species)
   Triacylglycerol lipase homologue

7. Species Aspergillus niger [TaxId:5061] [102632] (5 PDB entries)
   Uniprot O42807 23-281

8. Domain d1uwca1: 1uwc A:1-260 [100101]
   Other proteins in same PDB: d1uwca2, d1uwcb2
   complexed with fer, nag, so4

Details for d1uwca1

PDB Entry: 1uwc, 1.08 Å

PDB Description: feruloyl esterase from aspergillus niger

PDB Compounds: (A:) feruloyl esterase a

SCOPe Domain Sequences for d1uwca1:

Sequence; same for both SEQRES and ATOM records:

>d1uwca1 c.69.1.17 (A:1-260) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactw

Timeline for d1uwca1:

• d1uwca1 first appeared in SCOP 1.67, called d1uwca_
  
• d1uwca1 appears in SCOPe 2.07