PDB entry 6jqq

View 6jqq on RCSB PDB site
Description: KatE H392C from Escherichia coli
Class: oxidoreductase
Keywords: KatE, catalase, mutant, OXIDOREDUCTASE
Deposited on 2019-04-01, released 2020-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Escherichia coli ISC7 [TaxId:1432555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W1F4G9 (Start-752)
      • engineered mutation (391)
    Domains in SCOPe 2.07: d6jqqa1, d6jqqa2
  • Chain 'B':
    Compound: catalase
    Species: Escherichia coli ISC7 [TaxId:1432555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W1F4G9 (Start-752)
      • engineered mutation (391)
    Domains in SCOPe 2.07: d6jqqb1, d6jqqb2
  • Chain 'C':
    Compound: catalase
    Species: Escherichia coli ISC7 [TaxId:1432555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W1F4G9 (Start-752)
      • engineered mutation (391)
    Domains in SCOPe 2.07: d6jqqc1, d6jqqc2
  • Chain 'D':
    Compound: catalase
    Species: Escherichia coli ISC7 [TaxId:1432555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W1F4G9 (Start-752)
      • engineered mutation (391)
    Domains in SCOPe 2.07: d6jqqd1, d6jqqd2
  • Heterogens: HEM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jqqA (A:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragnrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafcpghivpgldftndpllqgrlfsyidtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnslkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikvadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jqqA (A:)
    slapshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvriad
    dqnslragnrgptlledfilrekithfdheriperivhargsaahgyfqpykslsditka
    dflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiffiqd
    ahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyrtme
    gfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaieagd
    fpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaeneqaa
    fcpghivpgldftndpllqgrlfsyidtqisrlggpnfheipinrptcpyhnfqrdgmhr
    mgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyyshprl
    fwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgieltddq
    lnitpppdvnslkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakgvha
    kllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylmeayk
    hlkpialagdarkfkatikvadqgeegiveadsadgsfmdelltlmaahrvwsripkidk
    ipa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jqqB (B:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragnrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafcpghivpgldftndpllqgrlfsyidtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnslkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikvadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jqqB (B:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragnrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafcpghivpgldftndpllqgrlfsyidtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnslkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikvadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jqqC (C:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragnrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafcpghivpgldftndpllqgrlfsyidtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnslkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikvadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jqqC (C:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragnrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafcpghivpgldftndpllqgrlfsyidtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnslkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikvdqgeegiveadsadgsfmdelltlmaahrvwsripki
    dkipa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jqqD (D:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragnrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafcpghivpgldftndpllqgrlfsyidtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnslkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikvadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jqqD (D:)
    lapedgshpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvria
    ddqnslragnrgptlledfilrekithfdheriperivhargsaahgyfqpykslsditk
    adflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiffiq
    dahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyrtm
    egfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaieag
    dfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaeneqa
    afcpghivpgldftndpllqgrlfsyidtqisrlggpnfheipinrptcpyhnfqrdgmh
    rmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyyshpr
    lfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgieltdd
    qlnitpppdvnslkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakgvh
    akllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylmeay
    khlkpialagdarkfkatikvadqgeegiveadsadgsfmdelltlmaahrvwsripkid
    kipa