Lineage for d6jqqc1 (6jqq C:28-597)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2620683Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2620684Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2620685Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2620841Protein automated matches [190051] (12 species)
    not a true protein
  7. 2620961Species Escherichia coli [TaxId:1432555] [382944] (1 PDB entry)
  8. 2620964Domain d6jqqc1: 6jqq C:28-597 [382977]
    Other proteins in same PDB: d6jqqa2, d6jqqb2, d6jqqc2, d6jqqd2
    automated match to d1cf9a2
    complexed with edo, hem

Details for d6jqqc1

PDB Entry: 6jqq (more details), 2.4 Å

PDB Description: kate h392c from escherichia coli
PDB Compounds: (C:) catalase

SCOPe Domain Sequences for d6jqqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jqqc1 e.5.1.1 (C:28-597) automated matches {Escherichia coli [TaxId: 1432555]}
slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
iaddqnslragnrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
tmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
qaafcpghivpgldftndpllqgrlfsyidtqisrlggpnfheipinrptcpyhnfqrdg
mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
ddqlnitpppdvnslkkdpslslyaipdgd

SCOPe Domain Coordinates for d6jqqc1:

Click to download the PDB-style file with coordinates for d6jqqc1.
(The format of our PDB-style files is described here.)

Timeline for d6jqqc1: