![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
![]() | Protein automated matches [190197] (24 species) not a true protein |
![]() | Species Escherichia coli [TaxId:1432555] [382946] (1 PDB entry) |
![]() | Domain d6jqqa2: 6jqq A:598-753 [383002] Other proteins in same PDB: d6jqqa1, d6jqqb1, d6jqqc1, d6jqqd1 automated match to d1p80a1 complexed with edo, hem |
PDB Entry: 6jqq (more details), 2.4 Å
SCOPe Domain Sequences for d6jqqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jqqa2 c.23.16.0 (A:598-753) automated matches {Escherichia coli [TaxId: 1432555]} vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikvadqgeeg iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d6jqqa2: