SCOPe 2.07: Structural Classification of Proteins

PDB entry 6frm

View 6frm on RCSB PDB site
Description: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Class: oxidoreductase
Keywords: Tb-Xo4, crystallophore, FprA, nucleation, phasing, anomalous, OXIDOREDUCTASE
Deposited on 2018-02-16, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
Database cross-references and differences (RAF-indexed):
- PDB 6FRM (0-End)
Domains in SCOPe 2.07: d6frma1, d6frma2
Chain 'B':
Compound: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
Database cross-references and differences (RAF-indexed):
- PDB 6FRM (0-End)
Domains in SCOPe 2.07: d6frmb1, d6frmb2
Chain 'C':
Compound: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
Database cross-references and differences (RAF-indexed):
- PDB 6FRM (0-End)
Domains in SCOPe 2.07: d6frmc1, d6frmc2
Chain 'D':
Compound: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
Database cross-references and differences (RAF-indexed):
- PDB 6FRM (0-End)
Domains in SCOPe 2.07: d6frmd1, d6frmd2
Chain 'E':
Compound: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
Database cross-references and differences (RAF-indexed):
- PDB 6FRM (0-End)
Domains in SCOPe 2.07: d6frme1, d6frme2
Chain 'F':
Compound: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
Database cross-references and differences (RAF-indexed):
- PDB 6FRM (0-End)
Domains in SCOPe 2.07: d6frmf1, d6frmf2
Chain 'G':
Compound: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
Database cross-references and differences (RAF-indexed):
- PDB 6FRM (0-End)
Domains in SCOPe 2.07: d6frmg1, d6frmg2
Chain 'H':
Compound: Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4
Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
Database cross-references and differences (RAF-indexed):
- PDB 6FRM (0-End)
Domains in SCOPe 2.07: d6frmh1, d6frmh2
Heterogens: FMN, 7MT, TB, CL, FE, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6frmA (A:)
mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkte