SCOPe 2.07: Domain d6frmc1: 6frm C:1-255

Lineage for d6frmc1 (6frm C:1-255)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358261] (4 PDB entries)

8. Domain d6frmc1: 6frm C:1-255 [359727]
   Other proteins in same PDB: d6frma2, d6frmb2, d6frmc2, d6frmd2, d6frme2, d6frmf2, d6frmg2, d6frmh2
   automated match to d2ohha1
   complexed with 7mt, cl, fe, fmn, tb

Details for d6frmc1

PDB Entry: 6frm, 2.2 Å

PDB Description: crystal structure of coenzyme f420h2 oxidase (fpra) co-crystallized with 10 mm tb-xo4

PDB Compounds: (C:) Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4

SCOPe Domain Sequences for d6frmc1:

Sequence; same for both SEQRES and ATOM records:

>d6frmc1 d.157.1.0 (C:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
pmkvigayqdfatgk

Timeline for d6frmc1:

• d6frmc1 is new in SCOPe 2.07-stable
  
• d6frmc1 appears in the current release, SCOPe 2.08