![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
![]() | Protein automated matches [190158] (30 species) not a true protein |
![]() | Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries) |
![]() | Domain d6frme2: 6frm E:256-407 [359680] Other proteins in same PDB: d6frma1, d6frmb1, d6frmc1, d6frmd1, d6frme1, d6frmf1, d6frmg1, d6frmh1 automated match to d2ohha2 complexed with 7mt, cl, fe, fmn, tb |
PDB Entry: 6frm (more details), 2.2 Å
SCOPe Domain Sequences for d6frme2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6frme2 c.23.5.0 (E:256-407) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]} ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev ldeyelyyvptedelekcynmgkrlavkvkem
Timeline for d6frme2: