PDB entry 6eti

View 6eti on RCSB PDB site
Description: Structure of inhibitor-bound ABCG2
Class: membrane protein
Keywords: Multidrug transporter, ABCG2, MZ29, inhibitor, MEMBRANE PROTEIN
Deposited on 2017-10-26, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-binding cassette sub-family G member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABCG2, ABCP, BCRP, BCRP1, MXR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP-binding cassette sub-family G member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABCG2, ABCP, BCRP, BCRP1, MXR
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 5D3(Fab) light chain variable domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ETI (0-End)
    Domains in SCOPe 2.07: d6etic1
  • Chain 'D':
    Compound: 5D3(Fab) heavy chain variable domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ETI
  • Chain 'E':
    Compound: 5D3(Fab) light chain variable domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ETI (0-End)
    Domains in SCOPe 2.07: d6etie1
  • Chain 'F':
    Compound: 5D3(Fab) heavy chain variable domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ETI
  • Heterogens: BWQ, NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6etiC (C:)
    divltqspssfsvslgdrvtisckasgyilnrlawyqqkpgnaprllisgatsletgfps
    rfsgtgsgkdytlsisslqtedvgtyycqqywstpwtfgggtkleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6etiC (C:)
    divltqspssfsvslgdrvtisckasgyilnrlawyqqkpgnaprllisgatsletgfps
    rfsgtgsgkdytlsisslqtedvgtyycqqywstpwtfgggtkleir
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6etiE (E:)
    divltqspssfsvslgdrvtisckasgyilnrlawyqqkpgnaprllisgatsletgfps
    rfsgtgsgkdytlsisslqtedvgtyycqqywstpwtfgggtkleirradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6etiE (E:)
    divltqspssfsvslgdrvtisckasgyilnrlawyqqkpgnaprllisgatsletgfps
    rfsgtgsgkdytlsisslqtedvgtyycqqywstpwtfgggtkleir
    

  • Chain 'F':
    No sequence available.