Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d6etie1: 6eti E:1-94 [350872] Other proteins in same PDB: d6etid1, d6etid2, d6etif1, d6etif2 automated match to d4odhl1 complexed with bwq |
PDB Entry: 6eti (more details), 3.1 Å
SCOPe Domain Sequences for d6etie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6etie1 b.1.1.0 (E:1-94) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspssfsvslgdrvtisckasgyilnrlawyqqkpgnaprllisgatsletgfps rfsgtgsgkdytlsisslqtedvgtyycqqywst
Timeline for d6etie1: