| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d6etid1: 6eti D:6-119 [411077] Other proteins in same PDB: d6etic1, d6etid2, d6etie1, d6etif2 automated match to d6shgh_ complexed with bwq |
PDB Entry: 6eti (more details), 3.1 Å
SCOPe Domain Sequences for d6etid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6etid1 b.1.1.1 (D:6-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esgpglvkpsqslsltctvtgfsitsdyawnwirqfpgkklewmgyinfdggttynpslr
grisitrdtsknqfflqlrsvtpedtatyycatfygakgtldywgqgtsvtvss
Timeline for d6etid1:
View in 3DDomains from other chains: (mouse over for more information) d6etic1, d6etie1, d6etif1, d6etif2 |