Lineage for d6etif1 (6eti F:6-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745003Domain d6etif1: 6eti F:6-119 [411079]
    Other proteins in same PDB: d6etic1, d6etid2, d6etie1, d6etif2
    automated match to d6shgh_
    complexed with bwq

Details for d6etif1

PDB Entry: 6eti (more details), 3.1 Å

PDB Description: structure of inhibitor-bound abcg2
PDB Compounds: (F:) 5D3(Fab) heavy chain variable domain

SCOPe Domain Sequences for d6etif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6etif1 b.1.1.1 (F:6-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esgpglvkpsqslsltctvtgfsitsdyawnwirqfpgkklewmgyinfdggttynpslr
grisitrdtsknqfflqlrsvtpedtatyycatfygakgtldywgqgtsvtvss

SCOPe Domain Coordinates for d6etif1:

Click to download the PDB-style file with coordinates for d6etif1.
(The format of our PDB-style files is described here.)

Timeline for d6etif1:

  • d6etif1 is new in SCOPe 2.08-stable