SCOPe 2.08: Domain d6etif1: 6eti F:6-119

Lineage for d6etif1 (6eti F:6-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d6etif1: 6eti F:6-119 [411079]
   Other proteins in same PDB: d6etic1, d6etid2, d6etie1, d6etif2
   automated match to d6shgh_
   complexed with bwq

Details for d6etif1

PDB Entry: 6eti, 3.1 Å

PDB Description: structure of inhibitor-bound abcg2

PDB Compounds: (F:) 5D3(Fab) heavy chain variable domain

SCOPe Domain Sequences for d6etif1:

Sequence; same for both SEQRES and ATOM records:

>d6etif1 b.1.1.1 (F:6-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esgpglvkpsqslsltctvtgfsitsdyawnwirqfpgkklewmgyinfdggttynpslr
grisitrdtsknqfflqlrsvtpedtatyycatfygakgtldywgqgtsvtvss

Timeline for d6etif1:

• d6etif1 is new in SCOPe 2.08-stable