PDB entry 6aqh

View 6aqh on RCSB PDB site
Description: Crystal Structure of Lysyl-tRNA Synthetase from Mycobacterium thermoresistibile complexed with L-lysine and Cladosporin
Class: ligase/inhibitor
Keywords: SSGCID, Lysine--tRNA ligase, synthetase, cladosporin, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LIGASE-INHIBITOR complex
Deposited on 2017-08-19, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine--tRNA ligase
    Species: Mycobacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) [TaxId:1078020]
    Gene: lysS, KEK_07907
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aqha1, d6aqha2
  • Chain 'B':
    Compound: Lysine--tRNA ligase
    Species: Mycobacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) [TaxId:1078020]
    Gene: lysS, KEK_07907
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aqhb1, d6aqhb2
  • Chain 'C':
    Compound: Lysine--tRNA ligase
    Species: Mycobacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) [TaxId:1078020]
    Gene: lysS, KEK_07907
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aqhc1, d6aqhc2
  • Chain 'D':
    Compound: Lysine--tRNA ligase
    Species: Mycobacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) [TaxId:1078020]
    Gene: lysS, KEK_07907
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aqhd1, d6aqhd2
  • Heterogens: LYS, KRS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aqhA (A:)
    mahhhhhhmtppesvdpdlpeqfrirqakradllaqgrqpypvdvprthtlleirqaypd
    lpvdartgeivgvtgrvvfarnsgklcfatlqegdgtqlqamislaevgqealdnwktyv
    digdivfvhgevitskrgelsvladswqmaakalrplpvahkemseesrvrqryvdlivr
    dqarkvarqriavmrairsalerrgflevetpmlqtlaggaaarpfvthsnaldtelylr
    iapelflkrclvggfervfelnrvfrnegadsthspefvmletyqaygtyddsavvtrel
    iqevadeaigtrqvplpdgtvydldgewesiqmypslsealgeeitpdtpaetlwaiadr
    lgldiprdrgyghgklveelwehtvgaklwaptfvkdfpvettpltrshrsipgvtekwd
    lyvrrielatgyseltdpiiqrerfeaqaraaaagddeamaldedflaaleygmppstgt
    gmgidrlmmtltglsiretvlfpivkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aqhA (A:)
    lpeqfrirqakradllaqgrqpypvdvprthtlleirqaypdlpvdartgeivgvtgrvv
    farnsgklcfatlqegdgtqlqamislaevgqealdnwktyvdigdivfvhgevitskrg
    elsvladswqmaakalrplpvahkemseesrvrqryvdlivrdqarkvarqriavmrair
    salerrgflevetpmlqtlaggaaarpfvthsnaldtelylriapelflkrclvggferv
    felnrvfrnegadsthspefvmletyqaygtyddsavvtreliqevadeaigtrqvplpd
    gtvydldgewesiqmypslsealgeeitpdtpaetlwaiadrlgldiprdrgyghgklve
    elwehtvgaklwaptfvkdfpvettpltrshrsipgvtekwdlyvrrielatgyseltdp
    iiqrerfeaqaraaaagddeamaldedflaaleygmppstgtgmgidrlmmtltglsire
    tvlfpiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aqhB (B:)
    mahhhhhhmtppesvdpdlpeqfrirqakradllaqgrqpypvdvprthtlleirqaypd
    lpvdartgeivgvtgrvvfarnsgklcfatlqegdgtqlqamislaevgqealdnwktyv
    digdivfvhgevitskrgelsvladswqmaakalrplpvahkemseesrvrqryvdlivr
    dqarkvarqriavmrairsalerrgflevetpmlqtlaggaaarpfvthsnaldtelylr
    iapelflkrclvggfervfelnrvfrnegadsthspefvmletyqaygtyddsavvtrel
    iqevadeaigtrqvplpdgtvydldgewesiqmypslsealgeeitpdtpaetlwaiadr
    lgldiprdrgyghgklveelwehtvgaklwaptfvkdfpvettpltrshrsipgvtekwd
    lyvrrielatgyseltdpiiqrerfeaqaraaaagddeamaldedflaaleygmppstgt
    gmgidrlmmtltglsiretvlfpivkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aqhB (B:)
    pdlpeqfrirqakradllaqgrqpypvdvprthtlleirqaypdlpvdartgeivgvtgr
    vvfarnsgklcfatlqegdgtqlqamislaevgqealdnwktyvdigdivfvhgevitsk
    rgelsvladswqmaakalrplpvahkemseesrvrqryvdlivrdqarkvarqriavmra
    irsalerrgflevetpmlqtlaggaaarpfvthsnaldtelylriapelflkrclvggfe
    rvfelnrvfrnegadsthspefvmletyqaygtyddsavvtreliqevadeaigtrqvpl
    pdgtvydldgewesiqmypslsealgeeitpdtpaetlwaiadrlgldiprdrgyghgkl
    veelwehtvgaklwaptfvkdfpvettpltrshrsipgvtekwdlyvrrielatgyselt
    dpiiqrerfeaqaraaaagddeamaldedflaaleygmppstgtgmgidrlmmtltglsi
    retvlfpivk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6aqhC (C:)
    mahhhhhhmtppesvdpdlpeqfrirqakradllaqgrqpypvdvprthtlleirqaypd
    lpvdartgeivgvtgrvvfarnsgklcfatlqegdgtqlqamislaevgqealdnwktyv
    digdivfvhgevitskrgelsvladswqmaakalrplpvahkemseesrvrqryvdlivr
    dqarkvarqriavmrairsalerrgflevetpmlqtlaggaaarpfvthsnaldtelylr
    iapelflkrclvggfervfelnrvfrnegadsthspefvmletyqaygtyddsavvtrel
    iqevadeaigtrqvplpdgtvydldgewesiqmypslsealgeeitpdtpaetlwaiadr
    lgldiprdrgyghgklveelwehtvgaklwaptfvkdfpvettpltrshrsipgvtekwd
    lyvrrielatgyseltdpiiqrerfeaqaraaaagddeamaldedflaaleygmppstgt
    gmgidrlmmtltglsiretvlfpivkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aqhC (C:)
    lpeqfrirqakradllaqgrqpypvdvprthtlleirqaypdlpvdartgeivgvtgrvv
    farnsgklcfatlqegdgtqlqamislaevgqealdnwktyvdigdivfvhgevitskrg
    elsvladswqmaakalrplpvahkemseesrvrqryvdlivrdqarkvarqriavmrair
    salerrgflevetpmlqtlaggaaarpfvthsnaldtelylriapelflkrclvggferv
    felnrvfrnegadsthspefvmletyqaygtyddsavvtreliqevadeaigtrqvplpd
    gtvydldgewesiqmypslsealgeeitpdtpaetlwaiadrlgldiprdrgyghgklve
    elwehtvgaklwaptfvkdfpvettpltrshrsipgvtekwdlyvrrielatgyseltdp
    iiqrerfeaqaraaaagddeamaldedflaaleygmppstgtgmgidrlmmtltglsire
    tvlfpiv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6aqhD (D:)
    mahhhhhhmtppesvdpdlpeqfrirqakradllaqgrqpypvdvprthtlleirqaypd
    lpvdartgeivgvtgrvvfarnsgklcfatlqegdgtqlqamislaevgqealdnwktyv
    digdivfvhgevitskrgelsvladswqmaakalrplpvahkemseesrvrqryvdlivr
    dqarkvarqriavmrairsalerrgflevetpmlqtlaggaaarpfvthsnaldtelylr
    iapelflkrclvggfervfelnrvfrnegadsthspefvmletyqaygtyddsavvtrel
    iqevadeaigtrqvplpdgtvydldgewesiqmypslsealgeeitpdtpaetlwaiadr
    lgldiprdrgyghgklveelwehtvgaklwaptfvkdfpvettpltrshrsipgvtekwd
    lyvrrielatgyseltdpiiqrerfeaqaraaaagddeamaldedflaaleygmppstgt
    gmgidrlmmtltglsiretvlfpivkpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aqhD (D:)
    dlpeqfrirqakradllaqgrqpypvdvprthtlleirqaypdlpvdartgeivgvtgrv
    vfarnsgklcfatlqegdgtqlqamislaevgqealdnwktyvdigdivfvhgevitskr
    gelsvladswqmaakalrplpvahkemseesrvrqryvdlivrdqarkvarqriavmrai
    rsalerrgflevetpmlqtlaggaaarpfvthsnaldtelylriapelflkrclvggfer
    vfelnrvfrnegadsthspefvmletyqaygtyddsavvtreliqevadeaigtrqvplp
    dgtvydldgewesiqmypslsealgeeitpdtpaetlwaiadrlgldiprdrgyghgklv
    eelwehtvgaklwaptfvkdfpvettpltrshrsipgvtekwdlyvrrielatgyseltd
    piiqrerfeaqaraaaagddeamaldedflaaleygmppstgtgmgidrlmmtltglsir
    etvlfpivk