SCOPe 2.08: Domain d6aqha2: 6aqh A:157-497

Lineage for d6aqha2 (6aqh A:157-497)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1078020] [338442] (1 PDB entry)

8. Domain d6aqha2: 6aqh A:157-497 [338446]
   Other proteins in same PDB: d6aqha1, d6aqhb1, d6aqhc1, d6aqhd1
   automated match to d3bjua2
   protein/RNA complex; complexed with edo, krs, lys

Details for d6aqha2

PDB Entry: 6aqh, 2.35 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium thermoresistibile complexed with l-lysine and cladosporin

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6aqha2:

Sequence; same for both SEQRES and ATOM records:

>d6aqha2 d.104.1.0 (A:157-497) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
seesrvrqryvdlivrdqarkvarqriavmrairsalerrgflevetpmlqtlaggaaar
pfvthsnaldtelylriapelflkrclvggfervfelnrvfrnegadsthspefvmlety
qaygtyddsavvtreliqevadeaigtrqvplpdgtvydldgewesiqmypslsealgee
itpdtpaetlwaiadrlgldiprdrgyghgklveelwehtvgaklwaptfvkdfpvettp
ltrshrsipgvtekwdlyvrrielatgyseltdpiiqrerfeaqaraaaagddeamalde
dflaaleygmppstgtgmgidrlmmtltglsiretvlfpiv

Timeline for d6aqha2:

• d6aqha2 first appeared in SCOPe 2.06
  
• d6aqha2 appears in SCOPe 2.07