![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Mycobacterium thermoresistibile [TaxId:1078020] [338442] (1 PDB entry) |
![]() | Domain d6aqha2: 6aqh A:157-497 [338446] Other proteins in same PDB: d6aqha1, d6aqhb1, d6aqhc1, d6aqhd1 automated match to d3bjua2 protein/RNA complex; complexed with edo, krs, lys |
PDB Entry: 6aqh (more details), 2.35 Å
SCOPe Domain Sequences for d6aqha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aqha2 d.104.1.0 (A:157-497) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]} seesrvrqryvdlivrdqarkvarqriavmrairsalerrgflevetpmlqtlaggaaar pfvthsnaldtelylriapelflkrclvggfervfelnrvfrnegadsthspefvmlety qaygtyddsavvtreliqevadeaigtrqvplpdgtvydldgewesiqmypslsealgee itpdtpaetlwaiadrlgldiprdrgyghgklveelwehtvgaklwaptfvkdfpvettp ltrshrsipgvtekwdlyvrrielatgyseltdpiiqrerfeaqaraaaagddeamalde dflaaleygmppstgtgmgidrlmmtltglsiretvlfpiv
Timeline for d6aqha2: