Lineage for d6aqha1 (6aqh A:11-156)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383832Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2383833Protein automated matches [190576] (41 species)
    not a true protein
  7. 2383921Species Mycobacterium thermoresistibile [TaxId:1078020] [338433] (1 PDB entry)
  8. 2383922Domain d6aqha1: 6aqh A:11-156 [338441]
    Other proteins in same PDB: d6aqha2, d6aqhb2, d6aqhc2, d6aqhd2
    automated match to d3bjua1
    protein/RNA complex; complexed with edo, krs, lys

Details for d6aqha1

PDB Entry: 6aqh (more details), 2.35 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium thermoresistibile complexed with l-lysine and cladosporin
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6aqha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aqha1 b.40.4.0 (A:11-156) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
lpeqfrirqakradllaqgrqpypvdvprthtlleirqaypdlpvdartgeivgvtgrvv
farnsgklcfatlqegdgtqlqamislaevgqealdnwktyvdigdivfvhgevitskrg
elsvladswqmaakalrplpvahkem

SCOPe Domain Coordinates for d6aqha1:

Click to download the PDB-style file with coordinates for d6aqha1.
(The format of our PDB-style files is described here.)

Timeline for d6aqha1: