Lineage for d6aqhb2 (6aqh B:157-498)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (18 species)
    not a true protein
  7. 2533014Species Mycobacterium thermoresistibile [TaxId:1078020] [338442] (1 PDB entry)
  8. 2533016Domain d6aqhb2: 6aqh B:157-498 [338445]
    Other proteins in same PDB: d6aqha1, d6aqhb1, d6aqhc1, d6aqhd1
    automated match to d3bjua2
    protein/RNA complex; complexed with edo, krs, lys

Details for d6aqhb2

PDB Entry: 6aqh (more details), 2.35 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium thermoresistibile complexed with l-lysine and cladosporin
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6aqhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aqhb2 d.104.1.0 (B:157-498) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
seesrvrqryvdlivrdqarkvarqriavmrairsalerrgflevetpmlqtlaggaaar
pfvthsnaldtelylriapelflkrclvggfervfelnrvfrnegadsthspefvmlety
qaygtyddsavvtreliqevadeaigtrqvplpdgtvydldgewesiqmypslsealgee
itpdtpaetlwaiadrlgldiprdrgyghgklveelwehtvgaklwaptfvkdfpvettp
ltrshrsipgvtekwdlyvrrielatgyseltdpiiqrerfeaqaraaaagddeamalde
dflaaleygmppstgtgmgidrlmmtltglsiretvlfpivk

SCOPe Domain Coordinates for d6aqhb2:

Click to download the PDB-style file with coordinates for d6aqhb2.
(The format of our PDB-style files is described here.)

Timeline for d6aqhb2: