PDB entry 5w75

View 5w75 on RCSB PDB site
Description: Crystal Structure of Reconstructed Bacterial Elongation Factor Node 168
Class: translation
Keywords: ancestral gene reconstruction, thermostability, EF-Tu, ASR, TRANSLATION
Deposited on 2017-06-19, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) [TaxId:309803]
    Gene: tuf, CTN_0991
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9K884 (0-390)
      • conflict (12)
      • conflict (118)
      • conflict (320)
      • conflict (332)
      • expression tag (391)
    Domains in SCOPe 2.07: d5w75a1, d5w75a2, d5w75a3, d5w75a4
  • Chain 'B':
    Compound: elongation factor tu
    Species: Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) [TaxId:309803]
    Gene: tuf, CTN_0991
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9K884 (0-390)
      • conflict (12)
      • conflict (118)
      • conflict (320)
      • conflict (332)
      • expression tag (391)
    Domains in SCOPe 2.07: d5w75b1, d5w75b2, d5w75b3, d5w75b4
  • Chain 'C':
    Compound: elongation factor tu
    Species: Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) [TaxId:309803]
    Gene: tuf, CTN_0991
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9K884 (0-390)
      • conflict (12)
      • conflict (118)
      • conflict (320)
      • conflict (332)
      • expression tag (391)
    Domains in SCOPe 2.07: d5w75c1, d5w75c2, d5w75c3, d5w75c4
  • Chain 'D':
    Compound: elongation factor tu
    Species: Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) [TaxId:309803]
    Gene: tuf, CTN_0991
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9K884 (0-390)
      • conflict (12)
      • conflict (118)
      • conflict (320)
      • conflict (332)
      • expression tag (391)
    Domains in SCOPe 2.07: d5w75d1, d5w75d2, d5w75d3, d5w75d4
  • Heterogens: GDP, MG, SO4, SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w75A (A:)
    tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
    eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
    pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleapddpnhe
    aykpiqelldamdnyipdpqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeve
    iiglsyeirktvvtsvemfrkeldegiagdnvgcllrgidkdevergqvlaapgsikphk
    rfkaevyvlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemeiel
    iypvaiekgqrfaireggrtvgagvvteviel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w75A (A:)
    tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
    eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
    pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleheaykpiq
    elldamdnyipdpqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeveiiglei
    rktvvtsvemfrkeldegiagdnvgcllrgidkdevergqvlaapgsikphkrfkaevyv
    lkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemeieliypvaiek
    gqrfaireggrtvgagvvteviel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w75B (B:)
    tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
    eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
    pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleapddpnhe
    aykpiqelldamdnyipdpqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeve
    iiglsyeirktvvtsvemfrkeldegiagdnvgcllrgidkdevergqvlaapgsikphk
    rfkaevyvlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemeiel
    iypvaiekgqrfaireggrtvgagvvteviel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w75B (B:)
    tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
    eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
    pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleheaykpiq
    elldamdnyipdpqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeveiiglse
    irktvvtsvemfrkeldegiagdnvgcllrgidkdevergqvlaapgsikphkrfkaevy
    vlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemeieliypvaie
    kgqrfaireggrtvgagvvteviel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w75C (C:)
    tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
    eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
    pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleapddpnhe
    aykpiqelldamdnyipdpqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeve
    iiglsyeirktvvtsvemfrkeldegiagdnvgcllrgidkdevergqvlaapgsikphk
    rfkaevyvlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemeiel
    iypvaiekgqrfaireggrtvgagvvteviel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w75C (C:)
    tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
    eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
    pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleanheaykp
    iqelldamdnyipdpqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeveiigl
    seirktvvtsvemfrkeldegiagdnvgcllrgidkdevergqvlaapgsikphkrfkae
    vyvlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemeieliypva
    iekgqrfaireggrtvgagvvteviel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w75D (D:)
    tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
    eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
    pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleapddpnhe
    aykpiqelldamdnyipdpqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeve
    iiglsyeirktvvtsvemfrkeldegiagdnvgcllrgidkdevergqvlaapgsikphk
    rfkaevyvlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemeiel
    iypvaiekgqrfaireggrtvgagvvteviel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w75D (D:)
    tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
    eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
    pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleanheaykp
    iqelldamdnyipdpqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeveiigl
    seirktvvtsvemfrkeldegiagdnvgcllrgidkdevergqvlaapgsikphkrfkae
    vyvlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemeieliypva
    iekgqrfaireggrtvgagvvteviel