Lineage for d5w75b2 (5w75 B:203-301)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793437Species Thermotoga neapolitana [TaxId:309803] [351492] (1 PDB entry)
  8. 2793439Domain d5w75b2: 5w75 B:203-301 [351509]
    Other proteins in same PDB: d5w75a1, d5w75a3, d5w75a4, d5w75b1, d5w75b3, d5w75b4, d5w75c1, d5w75c3, d5w75c4, d5w75d1, d5w75d3, d5w75d4
    automated match to d1b23p1
    complexed with gdp, mg, so4

Details for d5w75b2

PDB Entry: 5w75 (more details), 2.3 Å

PDB Description: crystal structure of reconstructed bacterial elongation factor node 168
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d5w75b2:

Sequence, based on SEQRES records: (download)

>d5w75b2 b.43.3.0 (B:203-301) automated matches {Thermotoga neapolitana [TaxId: 309803]}
pqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeveiiglsyeirktvvtsvem
frkeldegiagdnvgcllrgidkdevergqvlaapgsikp

Sequence, based on observed residues (ATOM records): (download)

>d5w75b2 b.43.3.0 (B:203-301) automated matches {Thermotoga neapolitana [TaxId: 309803]}
pqrdvdkpflmpiedvfsitgrgtvvtgriergrirpgdeveiiglseirktvvtsvemf
rkeldegiagdnvgcllrgidkdevergqvlaapgsikp

SCOPe Domain Coordinates for d5w75b2:

Click to download the PDB-style file with coordinates for d5w75b2.
(The format of our PDB-style files is described here.)

Timeline for d5w75b2: