Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Thermotoga neapolitana [TaxId:309803] [351490] (1 PDB entry) |
Domain d5w75c1: 5w75 C:9-202 [351504] Other proteins in same PDB: d5w75a2, d5w75a3, d5w75a4, d5w75b2, d5w75b3, d5w75b4, d5w75c2, d5w75c3, d5w75c4, d5w75d2, d5w75d3, d5w75d4 automated match to d1b23p3 complexed with gdp, mg, so4 |
PDB Entry: 5w75 (more details), 2.3 Å
SCOPe Domain Sequences for d5w75c1:
Sequence, based on SEQRES records: (download)
>d5w75c1 c.37.1.0 (C:9-202) automated matches {Thermotoga neapolitana [TaxId: 309803]} tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleapddpnhe aykpiqelldamdnyipd
>d5w75c1 c.37.1.0 (C:9-202) automated matches {Thermotoga neapolitana [TaxId: 309803]} tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleanheaykp iqelldamdnyipd
Timeline for d5w75c1: