Lineage for d5w75c1 (5w75 C:9-202)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873028Species Thermotoga neapolitana [TaxId:309803] [351490] (1 PDB entry)
  8. 2873031Domain d5w75c1: 5w75 C:9-202 [351504]
    Other proteins in same PDB: d5w75a2, d5w75a3, d5w75a4, d5w75b2, d5w75b3, d5w75b4, d5w75c2, d5w75c3, d5w75c4, d5w75d2, d5w75d3, d5w75d4
    automated match to d1b23p3
    complexed with gdp, mg, so4

Details for d5w75c1

PDB Entry: 5w75 (more details), 2.3 Å

PDB Description: crystal structure of reconstructed bacterial elongation factor node 168
PDB Compounds: (C:) elongation factor tu

SCOPe Domain Sequences for d5w75c1:

Sequence, based on SEQRES records: (download)

>d5w75c1 c.37.1.0 (C:9-202) automated matches {Thermotoga neapolitana [TaxId: 309803]}
tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleapddpnhe
aykpiqelldamdnyipd

Sequence, based on observed residues (ATOM records): (download)

>d5w75c1 c.37.1.0 (C:9-202) automated matches {Thermotoga neapolitana [TaxId: 309803]}
tkphvnvgtighvdhgkstltaaitkylslkglaqyvpydqidkapeekargitinithv
eyetekrhyahidcpghadyiknmitgaaqmdgailvvaatdgpmpqtrehvllarqvgv
pymivfinktdmvddpelielvemevrdllsqyeypgdevpvikgsalkaleanheaykp
iqelldamdnyipd

SCOPe Domain Coordinates for d5w75c1:

Click to download the PDB-style file with coordinates for d5w75c1.
(The format of our PDB-style files is described here.)

Timeline for d5w75c1: