Lineage for d5w75d3 (5w75 D:302-394)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794073Species Thermotoga neapolitana [TaxId:309803] [351494] (1 PDB entry)
  8. 2794077Domain d5w75d3: 5w75 D:302-394 [351495]
    Other proteins in same PDB: d5w75a1, d5w75a2, d5w75a4, d5w75b1, d5w75b2, d5w75b4, d5w75c1, d5w75c2, d5w75c4, d5w75d1, d5w75d2, d5w75d4
    automated match to d1b23p2
    complexed with gdp, mg, so4

Details for d5w75d3

PDB Entry: 5w75 (more details), 2.3 Å

PDB Description: crystal structure of reconstructed bacterial elongation factor node 168
PDB Compounds: (D:) elongation factor tu

SCOPe Domain Sequences for d5w75d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w75d3 b.44.1.0 (D:302-394) automated matches {Thermotoga neapolitana [TaxId: 309803]}
hkrfkaevyvlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemei
eliypvaiekgqrfaireggrtvgagvvtevie

SCOPe Domain Coordinates for d5w75d3:

Click to download the PDB-style file with coordinates for d5w75d3.
(The format of our PDB-style files is described here.)

Timeline for d5w75d3: