Class b: All beta proteins [48724] (180 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Thermotoga neapolitana [TaxId:309803] [351494] (1 PDB entry) |
Domain d5w75d3: 5w75 D:302-394 [351495] Other proteins in same PDB: d5w75a1, d5w75a2, d5w75a4, d5w75b1, d5w75b2, d5w75b4, d5w75c1, d5w75c2, d5w75c4, d5w75d1, d5w75d2, d5w75d4 automated match to d1b23p2 complexed with gdp, mg, so4 |
PDB Entry: 5w75 (more details), 2.3 Å
SCOPe Domain Sequences for d5w75d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w75d3 b.44.1.0 (D:302-394) automated matches {Thermotoga neapolitana [TaxId: 309803]} hkrfkaevyvlkkeeggrhtpffkgykpqfyirttdvtgeivlpegvemvmpgdhvemei eliypvaiekgqrfaireggrtvgagvvtevie
Timeline for d5w75d3: