PDB entry 5ig5

View 5ig5 on RCSB PDB site
Description: Crystal structure of N. vectensis CaMKII-B hub at pH 4.2
Class: transferase
Keywords: Ca2+/CaM-dependent kinase, sea anemone, peptide docking, open-spiral, TRANSFERASE
Deposited on 2016-02-26, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CaMKII-B hub
    Species: Nematostella vectensis [TaxId:45351]
    Gene: v1g157808
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7RF52 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5ig5a1, d5ig5a2
  • Chain 'B':
    Compound: CaMKII-B hub
    Species: Nematostella vectensis [TaxId:45351]
    Gene: v1g157808
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7RF52 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5ig5b1, d5ig5b2
  • Chain 'C':
    Compound: CaMKII-B hub
    Species: Nematostella vectensis [TaxId:45351]
    Gene: v1g157808
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7RF52 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5ig5c1, d5ig5c2
  • Chain 'D':
    Compound: CaMKII-B hub
    Species: Nematostella vectensis [TaxId:45351]
    Gene: v1g157808
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ig5d_
  • Chain 'E':
    Compound: CaMKII-B hub
    Species: Nematostella vectensis [TaxId:45351]
    Gene: v1g157808
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7RF52 (3-144)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5ig5e1, d5ig5e2
  • Chain 'F':
    Compound: CaMKII-B hub
    Species: Nematostella vectensis [TaxId:45351]
    Gene: v1g157808
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7RF52 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5ig5f1, d5ig5f2
  • Chain 'G':
    Compound: CaMKII-B hub
    Species: Nematostella vectensis [TaxId:45351]
    Gene: v1g157808
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7RF52 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5ig5g1, d5ig5g2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ig5A (A:)
    gphtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqv
    eglefhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqs
    eetrvwqkkkgvwlnvhfhrsvsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig5A (A:)
    htiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqveg
    lefhkfyfdnlpttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvw
    qkkkgvwlnvhfhrsvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ig5B (B:)
    gphtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqv
    eglefhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqs
    eetrvwqkkkgvwlnvhfhrsvsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig5B (B:)
    htiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqveg
    lefhkfyfdnlpttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvw
    qkkkgvwlnvhfhrsvsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ig5C (C:)
    gphtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqv
    eglefhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqs
    eetrvwqkkkgvwlnvhfhrsvsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig5C (C:)
    htiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqveg
    lefhkfyfdnlptvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvwq
    kkkgvwlnvhfhrsvsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ig5D (D:)
    gphtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqv
    eglefhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqs
    eetrvwqkkkgvwlnvhfhrsvsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig5D (D:)
    tiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqvegl
    efhkfyfdnlttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvwqk
    kkgvwlnvhfhrsvsr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ig5E (E:)
    gphtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqv
    eglefhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqs
    eetrvwqkkkgvwlnvhfhrsvsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig5E (E:)
    phtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqve
    glefhkfyfdnlptvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvw
    qkkkgvwlnvhfhrsvsrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ig5F (F:)
    gphtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqv
    eglefhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqs
    eetrvwqkkkgvwlnvhfhrsvsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig5F (F:)
    phtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqve
    glefhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqse
    etrvwqkkkgvwlnvhfhrsvsr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ig5G (G:)
    gphtiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqv
    eglefhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqs
    eetrvwqkkkgvwlnvhfhrsvsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig5G (G:)
    htiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqveg
    lefhkfyfdnlpttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvw
    qkkkgvwlnvhfhrsvsr