Lineage for d5ig5d_ (5ig5 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543869Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
    automatically mapped to Pfam PF13474
    automatically mapped to Pfam PF08332
  6. 2543890Protein automated matches [190404] (2 species)
    not a true protein
  7. 2543924Species Nematostella vectensis [TaxId:45351] [314988] (1 PDB entry)
  8. 2543928Domain d5ig5d_: 5ig5 D: [315641]
    Other proteins in same PDB: d5ig5a2, d5ig5b2, d5ig5c2, d5ig5e2, d5ig5f2, d5ig5g2
    automated match to d1hkxe_

Details for d5ig5d_

PDB Entry: 5ig5 (more details), 3 Å

PDB Description: crystal structure of n. vectensis camkii-b hub at ph 4.2
PDB Compounds: (D:) CaMKII-B hub

SCOPe Domain Sequences for d5ig5d_:

Sequence, based on SEQRES records: (download)

>d5ig5d_ d.17.4.7 (D:) automated matches {Nematostella vectensis [TaxId: 45351]}
tiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqvegl
efhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseet
rvwqkkkgvwlnvhfhrsvsr

Sequence, based on observed residues (ATOM records): (download)

>d5ig5d_ d.17.4.7 (D:) automated matches {Nematostella vectensis [TaxId: 45351]}
tiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqvegl
efhkfyfdnlttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvwqk
kkgvwlnvhfhrsvsr

SCOPe Domain Coordinates for d5ig5d_:

Click to download the PDB-style file with coordinates for d5ig5d_.
(The format of our PDB-style files is described here.)

Timeline for d5ig5d_: