SCOPe 2.07: Domain d5ig5a1: 5ig5 A:333-472

Lineage for d5ig5a1 (5ig5 A:333-472)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
   automatically mapped to Pfam PF13474
   automatically mapped to Pfam PF08332

6. Protein automated matches [190404] (2 species)
   not a true protein

7. Species Nematostella vectensis [TaxId:45351] [314988] (1 PDB entry)

8. Domain d5ig5a1: 5ig5 A:333-472 [314992]
   Other proteins in same PDB: d5ig5a2, d5ig5b2, d5ig5c2, d5ig5e2, d5ig5f2, d5ig5g2
   automated match to d1hkxe_

Details for d5ig5a1

PDB Entry: 5ig5, 3 Å

PDB Description: crystal structure of n. vectensis camkii-b hub at ph 4.2

PDB Compounds: (A:) CaMKII-B hub

SCOPe Domain Sequences for d5ig5a1:

Sequence, based on SEQRES records:

>d5ig5a1 d.17.4.7 (A:333-472) automated matches {Nematostella vectensis [TaxId: 45351]}
tiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqvegl
efhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseet
rvwqkkkgvwlnvhfhrsvs

Sequence, based on observed residues (ATOM records):

>d5ig5a1 d.17.4.7 (A:333-472) automated matches {Nematostella vectensis [TaxId: 45351]}
tiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqvegl
efhkfyfdnlpttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvwq
kkkgvwlnvhfhrsvs

Timeline for d5ig5a1:

• d5ig5a1 first appeared in SCOPe 2.06
  
• d5ig5a1 appears in the current release, SCOPe 2.08