PDB entry 3whc

View 3whc on RCSB PDB site
Description: Crystal structure of a transcriptional regulator FadR from Bacillus subtilis in complex with stearoyl-CoA
Class: transcription
Keywords: transcriptional regulator, fatty acid degradation, TRANSCRIPTION
Deposited on 2013-08-23, released 2014-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid metabolism regulator protein
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fadR, ysiA, BSU28550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whca1, d3whca2
  • Chain 'B':
    Compound: fatty acid metabolism regulator protein
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fadR, ysiA, BSU28550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whcb1, d3whcb2
  • Chain 'C':
    Compound: fatty acid metabolism regulator protein
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fadR, ysiA, BSU28550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whcc1, d3whcc2
  • Chain 'D':
    Compound: fatty acid metabolism regulator protein
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fadR, ysiA, BSU28550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whcd1, d3whcd2
  • Chain 'E':
    Compound: fatty acid metabolism regulator protein
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fadR, ysiA, BSU28550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whce1, d3whce2
  • Chain 'F':
    Compound: fatty acid metabolism regulator protein
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: fadR, ysiA, BSU28550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3whcf1, d3whcf2
  • Heterogens: ST9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3whcA (A:)
    mkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfke
    kmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkin
    eilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvals
    nsvlellvsgihnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whcA (A:)
    krpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmg
    qfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineil
    kgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsv
    lellvsgihn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3whcB (B:)
    mkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfke
    kmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkin
    eilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvals
    nsvlellvsgihnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whcB (B:)
    pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
    iermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkg
    ylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvle
    llvsgihn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3whcC (C:)
    mkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfke
    kmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkin
    eilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvals
    nsvlellvsgihnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whcC (C:)
    rpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgq
    fiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilk
    gylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvl
    ellvsgihnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3whcD (D:)
    mkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfke
    kmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkin
    eilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvals
    nsvlellvsgihnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whcD (D:)
    pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
    iermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkg
    ylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvle
    llvsgihn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3whcE (E:)
    mkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfke
    kmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkin
    eilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvals
    nsvlellvsgihnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whcE (E:)
    krpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmg
    qfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineil
    kgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsv
    lellvsgihn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3whcF (F:)
    mkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfke
    kmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkin
    eilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvals
    nsvlellvsgihnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3whcF (F:)
    kymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqfi
    ermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgy
    lnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlel
    lvsgih