![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [267907] (2 PDB entries) |
![]() | Domain d3whcc1: 3whc C:5-77 [265655] Other proteins in same PDB: d3whca2, d3whcb2, d3whcc2, d3whcd2, d3whce2, d3whcf2 automated match to d1vi0a1 complexed with st9 |
PDB Entry: 3whc (more details), 2.2 Å
SCOPe Domain Sequences for d3whcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3whcc1 a.4.1.0 (C:5-77) automated matches {Bacillus subtilis [TaxId: 224308]} rpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgq fiermeedikeka
Timeline for d3whcc1: