SCOPe 2.08: Domain d3whca2: 3whc A:78-193

Lineage for d3whca2 (3whc A:78-193)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [267908] (2 PDB entries)

8. Domain d3whca2: 3whc A:78-193 [265652]
   Other proteins in same PDB: d3whca1, d3whcb1, d3whcc1, d3whcd1, d3whce1, d3whcf1
   automated match to d1vi0a2
   complexed with st9

Details for d3whca2

PDB Entry: 3whc, 2.2 Å

PDB Description: crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa

PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whca2:

Sequence; same for both SEQRES and ATOM records:

>d3whca2 a.121.1.1 (A:78-193) automated matches {Bacillus subtilis [TaxId: 224308]}
takeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkgylnildgilteg
iqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvlellvsgihn

Timeline for d3whca2:

• d3whca2 first appeared in SCOPe 2.05
  
• d3whca2 appears in SCOPe 2.07