Lineage for d3whcd1 (3whc D:6-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692731Species Bacillus subtilis [TaxId:224308] [267907] (2 PDB entries)
  8. 2692737Domain d3whcd1: 3whc D:6-77 [265657]
    Other proteins in same PDB: d3whca2, d3whcb2, d3whcc2, d3whcd2, d3whce2, d3whcf2
    automated match to d1vi0a1
    complexed with st9

Details for d3whcd1

PDB Entry: 3whc (more details), 2.2 Å

PDB Description: crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
PDB Compounds: (D:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d3whcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3whcd1 a.4.1.0 (D:6-77) automated matches {Bacillus subtilis [TaxId: 224308]}
pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
iermeedikeka

SCOPe Domain Coordinates for d3whcd1:

Click to download the PDB-style file with coordinates for d3whcd1.
(The format of our PDB-style files is described here.)

Timeline for d3whcd1: