PDB entry 3btq

View 3btq on RCSB PDB site
Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Class: hydrolase/hydrolase inhibitor
Keywords: trypsin, bpti, serine proteinase, inhibitor
Deposited on 1999-03-10, released 2000-03-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (trypsin)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.55: d3btqe_
  • Chain 'I':
    Compound: protein (bovine pancreatic trypsin inhibitor)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (Start-57)
      • mutation (14)
      • mutation (51)
    Domains in SCOP 1.55: d3btqi_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3btqE (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3btqI (I:)
dfcleppytgpcqariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga