Lineage for d3btqe_ (3btq E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d3btqe_: 3btq E: [25946]
Other proteins in same PDB: d3btqi_
Details for d3btqe_
PDB Entry: 3btq (more details), 1.9 Å
PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
PDB Compounds: (E:) protein (trypsin)SCOP Domain Sequences for d3btqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3btqe_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d3btqe_:
Click to download the PDB-style file with coordinates for d3btqe_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3btqe_:
- d3btqe_ appears in SCOP 1.57
- d3btqe_ appears in the current release, SCOPe 2.08
View in 3D
