PDB entry 2ovq

View 2ovq on RCSB PDB site
Description: Structure of the Skp1-Fbw7-CyclinEdegC complex
Class: transcription/cell cycle
Keywords: F-box; WD40 domains; double phosphorylation, TRANSCRIPTION-CELL CYCLE COMPLEX
Deposited on 2007-02-14, released 2007-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-phase kinase-associated protein 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1A, EMC19, OCP2, SKP1, TCEB1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ovqa1, d2ovqa2
  • Chain 'B':
    Compound: F-box/WD repeat protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: FBXW7, FBW7, FBX30, SEL10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ovqb1, d2ovqb2
  • Chain 'C':
    Compound: cyclinE C-terminal degron
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2OVQ (0-11)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ovqA (A:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
    ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
    irktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovqA (A:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhdi
    pvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikndf
    teeeeaqvrkenqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ovqB (B:)
    tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr
    ekckeegideplhikrrkvikpgfihspwksayirqhridtnwrrgelkspkvlkghddh
    vitclqfcgnrivsgsddntlkvwsavtgkclrtlvghtggvwssqmrdniiisgstdrt
    lkvwnaetgecihtlyghtstvrcmhlhekrvvsgsrdatlrvwdietgqclhvlmghva
    avrcvqydgrrvvsgaydfmvkvwdpetetclhtlqghtnrvyslqfdgihvvsgsldts
    irvwdvetgncihtltghqsltsgmelkdnilvsgnadstvkiwdiktgqclqtlqgpnk
    hqsavtclqfnknfvitssddgtvklwdlktgefirnlvtlesggsggvvwrirasntkl
    vcavgsrngteetkllvldfdvdmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovqB (B:)
    tqvkhmmqviepqfqrdfisllpkelalyvlsflepkdllqaaqtcrywrilaednllwr
    ekckeegideplhikrrkvikpgfihspwksayirqhridtnwrrgelkspkvlkghddh
    vitclqfcgnrivsgsddntlkvwsavtgkclrtlvghtggvwssqmrdniiisgstdrt
    lkvwnaetgecihtlyghtstvrcmhlhekrvvsgsrdatlrvwdietgqclhvlmghva
    avrcvqydgrrvvsgaydfmvkvwdpetetclhtlqghtnrvyslqfdgihvvsgsldts
    irvwdvetgncihtltghqsltsgmelkdnilvsgnadstvkiwdiktgqclqtlqgpnk
    hqsavtclqfnknfvitssddgtvklwdlktgefirnlvtlesggsggvvwrirasntkl
    vcavgsrngteetkllvldfdvdm
    

  • Chain 'C':
    No sequence available.