Lineage for d2ovqb2 (2ovq B:2365-2706)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2075799Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2075800Family b.69.4.1: WD40-repeat [50979] (13 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2075868Protein F-box/WD repeat-containing protein 7, FBXW7 [159259] (1 species)
  7. 2075869Species Human (Homo sapiens) [TaxId:9606] [159260] (3 PDB entries)
    Uniprot Q969H0 365-706
  8. 2075871Domain d2ovqb2: 2ovq B:2365-2706 [145734]
    Other proteins in same PDB: d2ovqa1, d2ovqa2, d2ovqb1
    automatically matched to 2OVP B:2365-2706
    complexed with so4

Details for d2ovqb2

PDB Entry: 2ovq (more details), 2.6 Å

PDB Description: structure of the skp1-fbw7-cyclinedegc complex
PDB Compounds: (B:) F-box/WD repeat protein 7

SCOPe Domain Sequences for d2ovqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovqb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}
wrrgelkspkvlkghddhvitclqfcgnrivsgsddntlkvwsavtgkclrtlvghtggv
wssqmrdniiisgstdrtlkvwnaetgecihtlyghtstvrcmhlhekrvvsgsrdatlr
vwdietgqclhvlmghvaavrcvqydgrrvvsgaydfmvkvwdpetetclhtlqghtnrv
yslqfdgihvvsgsldtsirvwdvetgncihtltghqsltsgmelkdnilvsgnadstvk
iwdiktgqclqtlqgpnkhqsavtclqfnknfvitssddgtvklwdlktgefirnlvtle
sggsggvvwrirasntklvcavgsrngteetkllvldfdvdm

SCOPe Domain Coordinates for d2ovqb2:

Click to download the PDB-style file with coordinates for d2ovqb2.
(The format of our PDB-style files is described here.)

Timeline for d2ovqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovqb1