![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries) |
![]() | Domain d2ovqa2: 2ovq A:1002-1065 [139385] Other proteins in same PDB: d2ovqa1, d2ovqb1, d2ovqb2 automatically matched to d1fqvb2 complexed with so4 |
PDB Entry: 2ovq (more details), 2.6 Å
SCOPe Domain Sequences for d2ovqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ovqa2 d.42.1.1 (A:1002-1065) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthh
Timeline for d2ovqa2: