PDB entry 2hvd

View 2hvd on RCSB PDB site
Description: Human nucleoside diphosphate kinase A complexed with ADP
Class: signaling protein,transferase
Keywords: complex ADP, signaling protein, transferase
Deposited on 2006-07-28, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hvda_
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hvdb_
  • Chain 'C':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hvdc_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hvdA (A:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvdA (A:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hvdB (B:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvdB (B:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hvdC (C:)
    mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
    faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
    dsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hvdC (C:)
    ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
    aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svesaekeiglwfhpeelvdytscaqnwiye