SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2hvdc_ (2hvd C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2173865Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2173958Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (6 PDB entries)
  8. 2173973Domain d2hvdc_: 2hvd C: [136803]
    automated match to d1jxva_
    complexed with adp

Details for d2hvdc_

PDB Entry: 2hvd (more details), 2.15 Å

PDB Description: Human nucleoside diphosphate kinase A complexed with ADP
PDB Compounds: (C:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d2hvdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvdc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeiglwfhpeelvdytscaqnwiye

SCOPe Domain Coordinates for d2hvdc_:

Click to download the PDB-style file with coordinates for d2hvdc_.
(The format of our PDB-style files is described here.)

Timeline for d2hvdc_: