Lineage for d2hvda_ (2hvd A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (7 PDB entries)
  8. Domain d2hvda_: 2hvd A: [136801]
    automated match to d1jxva_
    complexed with adp

Details for d2hvda_

PDB Entry: 2hvd (more details), 2.15 Å

PDB Description: human nucleoside diphosphate kinase a complexed with adp
PDB Compounds: (A:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d2hvda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvda_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeiglwfhpeelvdytscaqnwiye

SCOPe Domain Coordinates for d2hvda_ are not available.

Timeline for d2hvda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hvdb_, d2hvdc_