SCOPe 2.08: Domain d2hvdb_: 2hvd B:

Lineage for d2hvdb_ (2hvd B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (7 PDB entries)

8. Domain d2hvdb_: 2hvd B: [136802]
   automated match to d1jxva_
   complexed with adp

Details for d2hvdb_

PDB Entry: 2hvd, 2.15 Å

PDB Description: human nucleoside diphosphate kinase a complexed with adp

PDB Compounds: (B:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d2hvdb_:

Sequence; same for both SEQRES and ATOM records:

>d2hvdb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svesaekeiglwfhpeelvdytscaqnwiye

Timeline for d2hvdb_:

• d2hvdb_ first appeared in SCOP 1.73, called d2hvdb1
  
• d2hvdb_ appears in SCOPe 2.07